PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011369.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 406aa    MW: 44336.9 Da    PI: 6.1431
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011369.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-174287147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd  l ++v  +G ++W++Iar ++ gR++k+c++rw + 
      Pbr011369.1 42 RGPWSPEEDAVLTRLVSNFGARNWSLIARGIP-GRSGKSCRLRWCNQ 87
                     89******************************.***********985 PP

2Myb_DNA-binding51.32.7e-1694138147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd ++v a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
      Pbr011369.1  94 RKPFSGEEDRIIVSAHAIHGNK-WAVIAKLLP-GRTDNAIKNHWNST 138
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.3753792IPR017930Myb domain
SuperFamilySSF466893.18E-3039135IPR009057Homeodomain-like
SMARTSM007172.7E-144190IPR001005SANT/Myb domain
PfamPF002494.1E-164287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-254395IPR009057Homeodomain-like
CDDcd001671.17E-134486No hitNo description
SMARTSM007173.0E-1693141IPR001005SANT/Myb domain
PROSITE profilePS5129421.17293143IPR017930Myb domain
PfamPF002493.2E-1494138IPR001005SANT/Myb domain
CDDcd001674.09E-1296139No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2396142IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MTVPNDGVSK EADDVPGTEA ELIELGNAAE LNEGAVRSGK VRGPWSPEED AVLTRLVSNF  60
GARNWSLIAR GIPGRSGKSC RLRWCNQLDP CVKRKPFSGE EDRIIVSAHA IHGNKWAVIA  120
KLLPGRTDNA IKNHWNSTLK RRCFDKVRFN PGPGEMMEDD TFDRKKASSE ETLSVGNISS  180
FKTCEGQAKE GCCAAESKEH STLRAESRDH LTLQSTLCRP VARVSAFSVY NRPSDPANAS  240
AFSRTVPSHG PLVPTTKLDF GFDNFLEGAC NEPMVPEHCS HGCCDRVEGH SQGSFLGPEF  300
VEYDEPPPFS SHELISIATD LNKIAWIKSS LESSTMSMPE NVASQRVGQA AATTLQMGVP  360
ANNPMNDHMR FEEGRNKLMG MMTEVLSTQV PRQTFAMPTE VEGLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-39411426107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3157830.0JN315783.1 Malus x domestica cultivar Golden Delicious R2R3-MYB transcription factor (MYB1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009351142.10.0PREDICTED: myb-related protein 306-like
TrEMBLA0FK200.0A0FK20_MALDO; MYB domain class transcription factor
STRINGVIT_13s0019g03200.t011e-144(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-98myb domain protein 109